| Name | Pannexin 3 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7072 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | Pannexin 3 antibody was raised using the middle region of PANX3 corresponding to a region with amino acids IISELDKSYNRSIRLVQHMLKIRQKSSDPYVFWNELEKARKERYFEFPLL |
| Purity/Format | Affinity purified |
| Blocking Peptide | Pannexin 3 Blocking Peptide |
| Description | Rabbit polyclonal Pannexin 3 antibody raised against the middle region of PANX3 |
| Gene | PANX3 |
| Supplier Page | Shop |