| Name | CARS antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4848 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | CARS antibody was raised using the middle region of CARS corresponding to a region with amino acids QEQEAAKLAKMKIPPSEMFLSETDKYSKFDENGLPTHDMEGKELSKGQAK |
| Purity/Format | Affinity purified |
| Blocking Peptide | CARS Blocking Peptide |
| Description | Rabbit polyclonal CARS antibody raised against the middle region of CARS |
| Gene | CARS2 |
| Supplier Page | Shop |