| Name | C1ORF74 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3760 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | C1ORF74 antibody was raised using the N terminal Of C1Orf74 corresponding to a region with amino acids ICLHLAGEVLAVARGLKPAVLYDCNCAGASELQSYLEELKGLGFLTFGLH |
| Purity/Format | Affinity purified |
| Blocking Peptide | C1ORF74 Blocking Peptide |
| Description | Rabbit polyclonal C1ORF74 antibody raised against the N terminal Of C1Orf74 |
| Gene | C1orf74 |
| Supplier Page | Shop |