Name | ITLN2 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4496 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | ITLN2 antibody was raised using the middle region of ITLN2 corresponding to a region with amino acids TVGDRWSSQQGNKADYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQA |
Purity/Format | Affinity purified |
Blocking Peptide | ITLN2 Blocking Peptide |
Description | Rabbit polyclonal ITLN2 antibody raised against the middle region of ITLN2 |
Gene | ITLN2 |
Supplier Page | Shop |