| Name | Mesothelin antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6174 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | Mesothelin antibody was raised using the middle region of MSLN corresponding to a region with amino acids QKLLGPHVEGLKAEERHRPVRDWILRQRQDDLDTLGLGLQGGIPNGYLVL |
| Purity/Format | Affinity purified |
| Blocking Peptide | Mesothelin Blocking Peptide |
| Description | Rabbit polyclonal Mesothelin antibody raised against the middle region of MSLN |
| Gene | MSLN |
| Supplier Page | Shop |