| Name | ABCG2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1773 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | ABCG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SGFLPCRKPVEKEILSNINGIMKPGLNAILGPTGGGKSSLLDVLAARKDP |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | ABCG2 Blocking Peptide |
| Description | Rabbit polyclonal ABCG2 antibody |
| Gene | ABCG2 |
| Supplier Page | Shop |