Name | ABCG2 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1773 |
Host | Rabbit |
Clonality | Polyclonal |
Applications | IHC WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | ABCG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SGFLPCRKPVEKEILSNINGIMKPGLNAILGPTGGGKSSLLDVLAARKDP |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | ABCG2 Blocking Peptide |
Description | Rabbit polyclonal ABCG2 antibody |
Gene | ABCG2 |
Supplier Page | Shop |