| Name | METTL5 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3600 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | METTL5 antibody was raised using the N terminal of METTL5 corresponding to a region with amino acids IAACMLYTIHNTYDDIENKVVADLGCGCGVLSIGTAMLGAGLCVGFDIDE |
| Purity/Format | Affinity purified |
| Blocking Peptide | METTL5 Blocking Peptide |
| Description | Rabbit polyclonal METTL5 antibody raised against the N terminal of METTL5 |
| Gene | METTL5 |
| Supplier Page | Shop |