ACPT antibody

Name ACPT antibody
Supplier Fitzgerald
Catalog 70R-7296
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen ACPT antibody was raised using the middle region of ACPT corresponding to a region with amino acids TLLALQGALGLYDGHTPPYAACLGFEFRKHLGNPAKDGGNVTVSLFYRND
Purity/Format Affinity purified
Blocking Peptide ACPT Blocking Peptide
Description Rabbit polyclonal ACPT antibody raised against the middle region of ACPT
Gene ACPT
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.