| Name | GMF gamma antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6206 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | GMF gamma antibody was raised using the middle region of GMFG corresponding to a region with amino acids KVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSY |
| Purity/Format | Affinity purified |
| Blocking Peptide | GMF gamma Blocking Peptide |
| Description | Rabbit polyclonal GMF gamma antibody raised against the middle region of GMFG |
| Gene | GMFG |
| Supplier Page | Shop |