| Name | PDE7B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2093 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | PDE7B antibody was raised using the middle region of PDE7B corresponding to a region with amino acids IGMLRESRLLAHLPKEMTQDIEQQLGSLILATDINRQNEFLTRLKAHLHN |
| Purity/Format | Affinity purified |
| Blocking Peptide | PDE7B Blocking Peptide |
| Description | Rabbit polyclonal PDE7B antibody raised against the middle region of PDE7B |
| Gene | PDE7B |
| Supplier Page | Shop |