| Name | WNT2B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1066 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | WNT2B antibody was raised using the middle region of WNT2B corresponding to a region with amino acids LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT |
| Purity/Format | Affinity Purified |
| Blocking Peptide | WNT2B Blocking Peptide |
| Description | Affinity purified rabbit polyclonal WNT2B antibody raised against the middle region of WNT2B |
| Gene | WNT2B |
| Supplier Page | Shop |