| Name | RGS11 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5810 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | RGS11 antibody was raised using the middle region of RGS11 corresponding to a region with amino acids LRQPHRYVLDDAQLHIYMLMKKDSYPRFLKSDMYKALLAEAGIPLEMKRR |
| Purity/Format | Affinity purified |
| Blocking Peptide | RGS11 Blocking Peptide |
| Description | Rabbit polyclonal RGS11 antibody raised against the middle region of RGS11 |
| Gene | RGS11 |
| Supplier Page | Shop |