| Name | ABHD7 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7489 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | ABHD7 antibody was raised using the N terminal of ABHD7 corresponding to a region with amino acids HCYVRIKDSGLRFHYVAAGERGKPLMLLLHGFPEFWYSWRYQLREFKSEY |
| Purity/Format | Affinity purified |
| Blocking Peptide | ABHD7 Blocking Peptide |
| Description | Rabbit polyclonal ABHD7 antibody raised against the N terminal of ABHD7 |
| Gene | EPHX4 |
| Supplier Page | Shop |