| Name | ARMCX6 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1805 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse |
| Antigen | ARMCX6 antibody was raised using the N terminal of ARMCX6 corresponding to a region with amino acids TMARPWTEDGDWTEPGAPGGTEDRPSGGGKANRAHPIKQRPFPYEHKNTW |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | ARMCX6 Blocking Peptide |
| Description | Rabbit polyclonal ARMCX6 antibody raised against the N terminal of ARMCX6 |
| Gene | ARMCX6 |
| Supplier Page | Shop |