| Name | RWDD4A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4176 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | RWDD4A antibody was raised using the N terminal of RWDD4A corresponding to a region with amino acids MSANEDQEMELEALRSIYEGDESFRELSPVSFQYRIGENGDPKAFLIEIS |
| Purity/Format | Affinity purified |
| Blocking Peptide | RWDD4A Blocking Peptide |
| Description | Rabbit polyclonal RWDD4A antibody raised against the N terminal of RWDD4A |
| Gene | RWDD4 |
| Supplier Page | Shop |