TMEM123 antibody

Name TMEM123 antibody
Supplier Fitzgerald
Catalog 70R-7328
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen TMEM123 antibody was raised using the C terminal of TMEM123 corresponding to a region with amino acids SSVTITTTMHSEAKKGSKFDTGSFVGGIVLTLGVLSILYIGCKMYYSRRG
Purity/Format Affinity purified
Blocking Peptide TMEM123 Blocking Peptide
Description Rabbit polyclonal TMEM123 antibody raised against the C terminal of TMEM123
Gene TMEM123
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.