NUDT9 antibody

Name NUDT9 antibody
Supplier Fitzgerald
Catalog 70R-5104
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen NUDT9 antibody was raised using a synthetic peptide corresponding to a region with amino acids SPKFNEKDGHVERKSKNGLYEIENGRPRNPAGRTGLVGRGLLGRWGPNHA
Purity/Format Affinity purified
Blocking Peptide NUDT9 Blocking Peptide
Description Rabbit polyclonal NUDT9 antibody
Gene NUDT9
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.