| Name | RHOBTB1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5842 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | RHOBTB1 antibody was raised using the middle region of RHOBTB1 corresponding to a region with amino acids DNQEYFERHRWPPVWYLKEEDHYQRVKREREKEDIALNKHRSRRKWCFWN |
| Purity/Format | Affinity purified |
| Blocking Peptide | RHOBTB1 Blocking Peptide |
| Description | Rabbit polyclonal RHOBTB1 antibody raised against the middle region of RHOBTB1 |
| Gene | RHOBTB1 |
| Supplier Page | Shop |