| Name | C17ORF39 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2926 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | C17ORF39 antibody was raised using the C terminal Of C17Orf39 corresponding to a region with amino acids SFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR |
| Purity/Format | Affinity purified |
| Blocking Peptide | C17ORF39 Blocking Peptide |
| Description | Rabbit polyclonal C17ORF39 antibody raised against the C terminal Of C17Orf39 |
| Gene | GID4 |
| Supplier Page | Shop |