Chymotrypsin-Like antibody

• Supplier: Fitzgerald
• Catalog: 70R-5490
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Chymotrypsin-Like antibody was raised using the N terminal of CTRL corresponding to a region with amino acids LLLSLTLSLVLLGSSWGCGIPAIKPALSFSQRIVNGENAVLGSWPWQVSL
• Purity/Format: Affinity purified
• Blocking Peptide: Chymotrypsin-Like Blocking Peptide
• Description: Rabbit polyclonal Chymotrypsin-Like antibody raised against the N terminal of CTRL
• Gene: CTRL