| Name | PAP2D antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6622 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | PAP2D antibody was raised using the N terminal of PAP2D corresponding to a region with amino acids FTVNVQGFFCHDSAYRKPYPGPEDSSAVPPVLLYSLAAGVPVLVIIVGET |
| Purity/Format | Affinity purified |
| Blocking Peptide | PAP2D Blocking Peptide |
| Description | Rabbit polyclonal PAP2D antibody raised against the N terminal of PAP2D |
| Gene | PPAP2A |
| Supplier Page | Shop |