| Name | RPL10A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3311 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | RPL10A antibody was raised using the N terminal of RPL10A corresponding to a region with amino acids MSSKVSRDTLYEAVREVLHGNQRKRRKFLETVELQISLKNYDPQKDKRFS |
| Purity/Format | Affinity purified |
| Blocking Peptide | RPL10A Blocking Peptide |
| Description | Rabbit polyclonal RPL10A antibody raised against the N terminal of RPL10A |
| Gene | RPL10A |
| Supplier Page | Shop |