TMEM195 antibody

Name TMEM195 antibody
Supplier Fitzgerald
Catalog 70R-6814
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen TMEM195 antibody was raised using the N terminal of TMEM195 corresponding to a region with amino acids VPDYVKKATPFFISLMLLELVVSWILKGKPPGRLDDALTSISAGVLSRLP
Purity/Format Affinity purified
Blocking Peptide TMEM195 Blocking Peptide
Description Rabbit polyclonal TMEM195 antibody raised against the N terminal of TMEM195
Gene AGMO
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.