| Name | HRSP12 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4592 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | HRSP12 antibody was raised using the N terminal of HRSP12 corresponding to a region with amino acids MSSLIRRVISTAKAPGAIGPYSQAVLVDRTIYISGQIGMDPSSGQLVSGG |
| Purity/Format | Affinity purified |
| Blocking Peptide | HRSP12 Blocking Peptide |
| Description | Rabbit polyclonal HRSP12 antibody raised against the N terminal of HRSP12 |
| Gene | HRSP12 |
| Supplier Page | Shop |