| Name | AK3 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5874 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | AK3 antibody was raised using the N terminal of AK3 corresponding to a region with amino acids MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGT |
| Purity/Format | Affinity purified |
| Blocking Peptide | AK3 Blocking Peptide |
| Description | Rabbit polyclonal AK3 antibody raised against the N terminal of AK3 |
| Gene | F9 |
| Supplier Page | Shop |