NXF1 antibody

Name NXF1 antibody
Supplier Fitzgerald
Catalog 70R-1323
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications IHC WB
Species Reactivities Human
Antigen NXF1 antibody was raised using the N terminal of NXF1 corresponding to a region with amino acids MADEGKSYSEHDDERVNFPQRKKKGRGPFRWKYGEGNRRSGRGGSGIRSS
Purity/Format Total IgG Protein A purified
Blocking Peptide NXF1 Blocking Peptide
Description Rabbit polyclonal NXF1 antibody raised against the N terminal of NXF1
Gene NXF1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.