| Name | CAB39 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3696 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | CAB39 antibody was raised using the middle region of CAB39 corresponding to a region with amino acids KTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRP |
| Purity/Format | Affinity purified |
| Blocking Peptide | CAB39 Blocking Peptide |
| Description | Rabbit polyclonal CAB39 antibody raised against the middle region of CAB39 |
| Gene | CAB39 |
| Supplier Page | Shop |