NELL2 antibody

Name NELL2 antibody
Supplier Fitzgerald
Catalog 70R-1709
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse
Antigen NELL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MESRVLLRTFCLIFGLGAVWGLGVDPSLQIDVLTELELGESTTGVRQVPG
Purity/Format Total IgG Protein A purified
Blocking Peptide NELL2 Blocking Peptide
Description Rabbit polyclonal NELL2 antibody
Gene NELL2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.