CCT5 antibody

Name CCT5 antibody
Supplier Fitzgerald
Catalog 70R-3888
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen CCT5 antibody was raised using a synthetic peptide corresponding to a region with amino acids DCLHKGTNDMKQQHVIETLIGKKQQISLATQMVRMILKIDDIRKPGESEE
Purity/Format Affinity purified
Blocking Peptide CCT5 Blocking Peptide
Description Rabbit polyclonal CCT5 antibody
Gene CCT5
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.