| Name | ST3GAL3 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7392 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | ST3GAL3 antibody was raised using the N terminal of ST3GAL3 corresponding to a region with amino acids MTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTK |
| Purity/Format | Affinity purified |
| Blocking Peptide | ST3GAL3 Blocking Peptide |
| Description | Rabbit polyclonal ST3GAL3 antibody raised against the N terminal of ST3GAL3 |
| Gene | ST3GAL3 |
| Supplier Page | Shop |