| Name | SEC22C antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6302 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | SEC22C antibody was raised using a synthetic peptide corresponding to a region with amino acids FRMEPVTALGILSLILNIMCAALNLIRGVHLAEHSLQVAHEEIGNILAFL |
| Purity/Format | Affinity purified |
| Blocking Peptide | SEC22C Blocking Peptide |
| Description | Rabbit polyclonal SEC22C antibody |
| Gene | SEC22C |
| Supplier Page | Shop |