| Name | AASDHPPT antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2638 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | AASDHPPT antibody was raised using the C terminal of AASDHPPT corresponding to a region with amino acids SRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEE |
| Purity/Format | Affinity purified |
| Blocking Peptide | AASDHPPT Blocking Peptide |
| Description | Rabbit polyclonal AASDHPPT antibody raised against the C terminal of AASDHPPT |
| Gene | AASDH |
| Supplier Page | Shop |