AASDHPPT antibody

Name AASDHPPT antibody
Supplier Fitzgerald
Catalog 70R-2638
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen AASDHPPT antibody was raised using the C terminal of AASDHPPT corresponding to a region with amino acids SRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEE
Purity/Format Affinity purified
Blocking Peptide AASDHPPT Blocking Peptide
Description Rabbit polyclonal AASDHPPT antibody raised against the C terminal of AASDHPPT
Gene AASDH
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.