| Name | TINAG antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4464 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | TINAG antibody was raised using the middle region of TINAG corresponding to a region with amino acids VAADRIAIQSKGRYTANLSPQNLISCCAKNRHGCNSGSIDRAWWYLRKRG |
| Purity/Format | Affinity purified |
| Blocking Peptide | TINAG Blocking Peptide |
| Description | Rabbit polyclonal TINAG antibody raised against the middle region of TINAG |
| Gene | TINAG |
| Supplier Page | Shop |