| Name | C20orf132 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4048 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | C20orf132 antibody was raised using the middle region of C20orf132 corresponding to a region with amino acids PHLENLDTIIKLPLRFQRLGHLVALMALLCGDPQEKVAEEAAEGIHSLLH |
| Purity/Format | Affinity purified |
| Blocking Peptide | C20orf132 Blocking Peptide |
| Description | Rabbit polyclonal C20orf132 antibody raised against the middle region of C20orf132 |
| Gene | MROH8 |
| Supplier Page | Shop |