| Name | ANP32A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5751 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | ANP32A antibody was raised using a synthetic peptide corresponding to a region with amino acids FNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDE |
| Purity/Format | Affinity purified |
| Blocking Peptide | ANP32A Blocking Peptide |
| Description | Rabbit polyclonal ANP32A antibody |
| Gene | ANP32A |
| Supplier Page | Shop |