| Name | SCUBE2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7430 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | SCUBE2 antibody was raised using the C terminal of SCUBE2 corresponding to a region with amino acids KTPEAWNMSECGGLCQPGEYSADGFAPCQLCALGTFQPEAGRTSCFPCGG |
| Purity/Format | Affinity purified |
| Blocking Peptide | SCUBE2 Blocking Peptide |
| Description | Rabbit polyclonal SCUBE2 antibody raised against the C terminal of SCUBE2 |
| Gene | SCUBE2 |
| Supplier Page | Shop |