| Name | Lipase J antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4117 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Lipase J antibody was raised using the C terminal of LIPJ corresponding to a region with amino acids LNLVHYNQTTSPLYNMTNMNVATAIWNGKSDLLADPEDVNILHSEITNHI |
| Purity/Format | Affinity purified |
| Blocking Peptide | Lipase J Blocking Peptide |
| Description | Rabbit polyclonal Lipase J antibody raised against the C terminal of LIPJ |
| Gene | LIPJ |
| Supplier Page | Shop |