SFRS8 antibody

Name SFRS8 antibody
Supplier Fitzgerald
Catalog 70R-4885
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse
Antigen SFRS8 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVFGYACKLFRDDERALAQEQGQHLIPWMGDHKILIDRYDGRGHLHDLSE
Purity/Format Affinity purified
Blocking Peptide SFRS8 Blocking Peptide
Description Rabbit polyclonal SFRS8 antibody
Gene SFSWAP
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.