| Name | GALT antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2643 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | GALT antibody was raised using the C terminal of GALT corresponding to a region with amino acids LLRSATVRKFMVGYEMLAQAQRDLTPEQAAERLRALPEVHYHLGQKDRET |
| Purity/Format | Affinity purified |
| Blocking Peptide | GALT Blocking Peptide |
| Description | Rabbit polyclonal GALT antibody raised against the C terminal of GALT |
| Gene | GALT |
| Supplier Page | Shop |