| Name | PHYHIP antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1231 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | PHYHIP antibody was raised using the N terminal of PHYHIP corresponding to a region with amino acids VSGWSETVEFCTGDYAKEHLAQLQEKAEQIAGRMLRFSVFYRNHHKEYFQ |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | PHYHIP Blocking Peptide |
| Description | Rabbit polyclonal PHYHIP antibody raised against the N terminal of PHYHIP |
| Gene | PHYHIP |
| Supplier Page | Shop |