Name | RPS27L antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4341 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | RPS27L antibody was raised using the N terminal of RPS27L corresponding to a region with amino acids MPLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHA |
Purity/Format | Affinity purified |
Blocking Peptide | RPS27L Blocking Peptide |
Description | Rabbit polyclonal RPS27L antibody raised against the N terminal of RPS27L |
Gene | RPS27 |
Supplier Page | Shop |