| Name | RPS27L antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4341 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | RPS27L antibody was raised using the N terminal of RPS27L corresponding to a region with amino acids MPLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHA |
| Purity/Format | Affinity purified |
| Blocking Peptide | RPS27L Blocking Peptide |
| Description | Rabbit polyclonal RPS27L antibody raised against the N terminal of RPS27L |
| Gene | RPS27 |
| Supplier Page | Shop |