| Name | PIGO antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7301 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | PIGO antibody was raised using the N terminal of PIGO corresponding to a region with amino acids LIDALRFDFAQPQHSHVPREPPVSLPFLGKLSSLQRILEIQPHHARLYRS |
| Purity/Format | Affinity purified |
| Blocking Peptide | PIGO Blocking Peptide |
| Description | Rabbit polyclonal PIGO antibody raised against the N terminal of PIGO |
| Gene | PIGO |
| Supplier Page | Shop |