Name | PIGO antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-7301 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | PIGO antibody was raised using the N terminal of PIGO corresponding to a region with amino acids LIDALRFDFAQPQHSHVPREPPVSLPFLGKLSSLQRILEIQPHHARLYRS |
Purity/Format | Affinity purified |
Blocking Peptide | PIGO Blocking Peptide |
Description | Rabbit polyclonal PIGO antibody raised against the N terminal of PIGO |
Gene | PIGO |
Supplier Page | Shop |