RSBN1 antibody

Name RSBN1 antibody
Supplier Fitzgerald
Catalog 70R-3989
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen RSBN1 antibody was raised using the N terminal of RSBN1 corresponding to a region with amino acids GGAVGPFKCVFVGEMAAQVGAVRVVRAVAAQEEPDKEGKEKPHAGVSPRG
Purity/Format Affinity purified
Blocking Peptide RSBN1 Blocking Peptide
Description Rabbit polyclonal RSBN1 antibody raised against the N terminal of RSBN1
Gene RSBN1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.