Name | RSBN1 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3989 |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | RSBN1 antibody was raised using the N terminal of RSBN1 corresponding to a region with amino acids GGAVGPFKCVFVGEMAAQVGAVRVVRAVAAQEEPDKEGKEKPHAGVSPRG |
Purity/Format | Affinity purified |
Blocking Peptide | RSBN1 Blocking Peptide |
Description | Rabbit polyclonal RSBN1 antibody raised against the N terminal of RSBN1 |
Gene | RSBN1 |
Supplier Page | Shop |