| Name | QTRTD1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2066 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | QTRTD1 antibody was raised using the N terminal of QTRTD1 corresponding to a region with amino acids YTKTGSAPHLTHHTLHNIHGVPAMAQLTLSSLAEHHEVLTEYKEGVGKFI |
| Purity/Format | Affinity purified |
| Blocking Peptide | QTRTD1 Blocking Peptide |
| Description | Rabbit polyclonal QTRTD1 antibody raised against the N terminal of QTRTD1 |
| Gene | QTRTD1 |
| Supplier Page | Shop |