| Name | IGSF11 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6403 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | IGSF11 antibody was raised using the middle region of IGSF11 corresponding to a region with amino acids EKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLL |
| Purity/Format | Affinity purified |
| Blocking Peptide | IGSF11 Blocking Peptide |
| Description | Rabbit polyclonal IGSF11 antibody raised against the middle region of IGSF11 |
| Gene | IGSF11 |
| Supplier Page | Shop |