Name | IQCK antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4181 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Rat |
Antigen | IQCK antibody was raised using the middle region of IQCK corresponding to a region with amino acids GMASLLHQAKKEKCFERKRTKFIACDFLTEWLYNQNPKRAGEPFTEFFSI |
Purity/Format | Affinity purified |
Blocking Peptide | IQCK Blocking Peptide |
Description | Rabbit polyclonal IQCK antibody raised against the middle region of IQCK |
Gene | IQCK |
Supplier Page | Shop |