GNGT2 antibody

Name GNGT2 antibody
Supplier Fitzgerald
Catalog 70R-3637
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen GNGT2 antibody was raised using the middle region of Gngt2 corresponding to a region with amino acids KEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS
Purity/Format Affinity purified
Blocking Peptide GNGT2 Blocking Peptide
Description Rabbit polyclonal GNGT2 antibody raised against the middle region of Gngt2
Gene GNG8
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.