Name | TAF7L antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-2547 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | TAF7L antibody was raised using a synthetic peptide corresponding to a region with amino acids QKQIEKKEKKLHKIQNKAQRQKDLIMKVENLTLKNHFQSVLEQLELQEKQ |
Purity/Format | Affinity purified |
Blocking Peptide | TAF7L Blocking Peptide |
Description | Rabbit polyclonal TAF7L antibody |
Gene | TAF7L |
Supplier Page | Shop |