| Name | CENPI antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3284 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | CENPI antibody was raised using the N terminal of CENPI corresponding to a region with amino acids SPQKRVKNVQAQNRTSQGSSSFQTTLSAWKVKQDPSNSKNISKHGQNNPV |
| Purity/Format | Affinity purified |
| Blocking Peptide | CENPI Blocking Peptide |
| Description | Rabbit polyclonal CENPI antibody raised against the N terminal of CENPI |
| Gene | CENPI |
| Supplier Page | Shop |